ich kann mein guthaben nicht aufladen vodafone

von: am: 30. Dezember 2020 02:36

"event" : "AcceptSolutionAction", }, { "revokeMode" : "true", "eventActions" : [ ] Ich kann meine Prepaid-Karte nicht aufladen. ] }, "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "disableLabelLinks" : "false", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_65b50b2b75783d","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_65b50b2b75783d_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/Archiv_CallYa/thread-id/61825&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"wtlsa3Hf1AmR-a4e1ryDj8RBlhUU4DLgclH9WBk7HXs. } var key = e.keyCode; } ] "action" : "rerender" } "action" : "rerender" "actions" : [ "context" : "envParam:feedbackData", "includeRepliesModerationState" : "false", { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", watching = false; LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "parameters" : { "event" : "markAsSpamWithoutRedirect", { "displaySubject" : "true", "actions" : [ }, "disallowZeroCount" : "false", ], } "action" : "rerender" $(document).ready(function(){ ] { { { "context" : "envParam:quiltName,expandedQuiltName", ] { "displayStyle" : "horizontal", count++; { "action" : "rerender" ] "kudosable" : "true", } { { var do_scroll = sessionStorage.is_scroll; "actions" : [ } } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1979181,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { } "action" : "rerender" ] B. wegen eines Zahlendrehers). "context" : "", "context" : "", { }, } $(event.data.selector).addClass('cssmenu-open') }, ] }, 8 февр. } "action" : "rerender" { "selector" : "#kudosButtonV2_1", Da mein Guthaben meines Vodafone Kontos am Handy aufgebraucht war habe ich, nicht zum ersten Mal, mir eine Aufladekarte gekauft. ;(function($){ ] "event" : "RevokeSolutionAction", var ctaHTML = ''; CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); "useSimpleView" : "false", "action" : "rerender" { ] } { LITHIUM.Dialog({ }; "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "MessagesWidgetEditAction", var keycodes = { $(document).ready(function(){ ] "useCountToKudo" : "false", "triggerEvent" : "LITHIUM:triggerDialogEvent", //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} "event" : "unapproveMessage", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "", "event" : "removeMessageUserEmailSubscription", element.children('ul').slideDown(); { "action" : "rerender" "context" : "envParam:feedbackData", "disableKudosForAnonUser" : "false", "parameters" : { "context" : "", count = 0; watching = true; }, { "context" : "", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); ] } LITHIUM.Dialog.options['-1828423795'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "}); { "event" : "ProductAnswer", "action" : "rerender" Ich habe jetzt zur Zeit Aldi Talk möchte aber zu Lidl Connect wechseln aufgrund des besseren Netz angeblich, da ich mit das Aldi Talk Netz ziemlich unzufrieden bin, hat einer mit Lidl Connect erfahrung ist das Netz wirklich besser oder nicht, und kann man Lidl Connect auch mit Vodafone Guthaben aufladen bzw über einem Automaten an der Bank bin für hilfreiche Antworten Erfahrungen Dankbar Ich kann auch nicht aufladen. { "context" : "lia-deleted-state", "selector" : "#messageview", }, { ] "context" : "", "context" : "envParam:selectedMessage", "event" : "kudoEntity", "event" : "AcceptSolutionAction", })(LITHIUM.jQuery); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); $('.community-menu').removeClass('active') "actions" : [ { return; { } $('li.close-on-click').on('click',resetMenu); B. bei Steam Spiele kaufen oder aber in Amazon Guthaben eintauschen. ] ] LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, "action" : "addClassName" { "action" : "rerender" "}); { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" //$('#lia-body').removeClass('lia-window-scroll'); window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":358,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFcKAFRWDlABBRgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVQV1AMUAYDXxQGW1VSSQFWVwZIDgMKAU8EUlAMA1FRUVRXDAFAThUPVn1bVgB\/AhsIQCNFB11aQm0mVwpVawNAG0ZeUGZXFkIwC2MXB0UdFwkWYSB6I3pmQgtTRHNhe39FWwNKQQMFUhcVZHx3N3NGTV0SC1RKXFcJDUV6L3R7NkIIRkhO"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ "selector" : "#kudosButtonV2_0", }); LITHIUM.Loader.runJsAttached(); Ich kann auch nicht aufladen. "disableLabelLinks" : "false", Dies ist entweder während des Registrierungsvorgangs per Hotline und online oder im O 2 Shop möglich. "action" : "rerender" "displaySubject" : "true", "event" : "addThreadUserEmailSubscription", LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "action" : "rerender" Lieferanten-Buchhaltung / Accounts Payable, Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_65b50b2b75783d_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/61825&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); Tipp: Aktualisier bitte regelmäßig Deine MeinVodafone-App. { "context" : "envParam:selectedMessage", "actions" : [ "event" : "kudoEntity", }, } "event" : "AcceptSolutionAction", "closeEvent" : "LITHIUM:lightboxCloseEvent", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); "action" : "rerender" Wie sind deine Erfahrungen mit der Abfragung des Vodafone Guthabens? ] "action" : "rerender" } "action" : "pulsate" "actions" : [ { "event" : "addThreadUserEmailSubscription", "actions" : [ "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); "useSimpleView" : "false", Zum Schluss wird Ihnen der Code direkt per E-Mail oder kostenlos per SMS zugeschickt. ] "selector" : "#kudosButtonV2_0", }, "action" : "pulsate" Antworten. }, "kudosable" : "true", "action" : "rerender" "action" : "rerender" count++; "context" : "", "event" : "deleteMessage", "event" : "addMessageUserEmailSubscription", "actions" : [ }, return; var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "actions" : [ $(event.data.selector).removeClass('cssmenu-open'); { { "displayStyle" : "horizontal", { "event" : "MessagesWidgetAnswerForm", "action" : "rerender" "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetAnswerForm", "includeRepliesModerationState" : "false", "context" : "", "context" : "lia-deleted-state", "linkDisabled" : "false" { }, Steht Dir kein Internet zur Verfügung, so kannst Du die Abfrage auch anhand eines Tastencodes oder per Anruf ausführen. { } var keycodes = { "closeEvent" : "LITHIUM:lightboxCloseEvent", { { Außerdem zeigen wir euch, wie ihr nachschaut, wie viel Guthaben ihr derzeit noch habt. "buttonDialogCloseAlt" : "Schließen", { }, event.preventDefault(); "event" : "RevokeSolutionAction", }, Da mein Guthaben meines Vodafone Kontos am Handy aufgebraucht war habe ich, nicht zum ersten Mal, mir eine Aufladekarte gekauft. window.scrollTo(0,position_x.top - 150); "action" : "rerender" "actions" : [ "displaySubject" : "true", } ] // Reset the conditions so that someone can do it all again. "context" : "envParam:quiltName", if ( neededkeys[count] == key ) { }, } LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); } "context" : "", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } }, ] { LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); "initiatorDataMatcher" : "data-lia-kudos-id" $('.lia-button-wrapper-searchForm-action').removeClass('active'); { ] "event" : "MessagesWidgetCommentForm", "action" : "rerender" Du bekommst jew­eils einen Code. } var cookieDomain = 'forum.vodafone.de'; $('.lia-button-wrapper-searchForm-action').removeClass('active'); "actions" : [ } "}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); "action" : "pulsate" ] //$('#lia-body').removeClass('lia-window-scroll'); "action" : "rerender" }, "actions" : [ { ] "context" : "envParam:quiltName,product,contextId,contextUrl", "componentId" : "forums.widget.message-view", document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); { "displaySubject" : "true", } LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "componentId" : "forums.widget.message-view", "action" : "rerender" "action" : "rerender" "useCountToKudo" : "false", "}); window.onclick = function(event) { Mit Guthaben.de können Sie Ihr Tchibo Prepaid Guthaben bequem von zu Hause in 30 Sekunden aufladen. return; { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ Unter der Option "Karte aufladen" erhalten Sie die Möglichkeit, Ihre CallYa-Karte per PayPal aufzuladen. { notifCount = parseInt($(this).html()) + notifCount; { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "useTruncatedSubject" : "true", }; "actions" : [ "context" : "", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); Sie wählen den Betrag aus, mit dem Sie Ihr Tchibo Handy Guthaben aufladen möchten. "actions" : [ "action" : "rerender" { { } } Wie das im Ausland funk­tioniert, haben wir für Sie in einem spezi­ellen Ratgeber zusam­menge­fasst. { $('.lia-autocomplete-footer').append(ctaHTML); "context" : "lia-deleted-state", "action" : "pulsate" Wenn ihr eine Prepaid-SIM-Karte von Vodafone habt und euer Guthaben zu Ende geht, könnt ihr es wieder aufladen. "actions" : [ "action" : "rerender" Lädt man innerhalb der einmonatigen Frist seine Karte erneut mit einem Guthaben auf, so bleibt die Karte aktiviert und eine Kündigung findet nicht statt. LITHIUM.AjaxSupport.ComponentEvents.set({ { watching = false; }, "linkDisabled" : "false" } { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); Normalerweise wurde ich dort durch das Hauptmenü dirigiert und habe dann meinen CashCode angegeben woraufhin mein Guthaben aufgeladen wurde. "actions" : [ ] { { // just for convenience, you need a login anyways... Das Guthaben ver­fällt zudem nicht, Du kannst es auch später immer noch ver­wen­den. "actions" : [ } ] } } "context" : "envParam:entity", "event" : "expandMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ... Wie kann ich mein Congstar Guthaben abfragen? "event" : "deleteMessage", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/61825","ajaxErrorEventName":"LITHIUM:ajaxError","token":"mH4KG58526KjhN0C6Di8v6zn7mP4jFuMJiXcm__lyrM. Mehr dazu: Wie übertrage ich Guthaben von Handy zu Handy? } "; { ] Ich bin kein Vielnutzer des Handys. ] $('section.header-announcement').slideUp(); "truncateBodyRetainsHtml" : "false", { } "actions" : [ "closeEvent" : "LITHIUM:lightboxCloseEvent", "event" : "ProductAnswer", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox","feedbackSelector":".InfoMessage"}); "showCountOnly" : "false", { "actions" : [ } "event" : "markAsSpamWithoutRedirect", }, { { "event" : "deleteMessage", "event" : "expandMessage", Seit 2019 hat sich die Ausrichtung des Unternehmens aber etwas geändert und Kunden können nun auch reine Prepaidkarten beim Discounter erwerben. //resetMenu(); ] ] "context" : "envParam:selectedMessage", { LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; } Mein BILDmobil: im Mitgliederbereich einfach Guthaben aufladen oder persönliche Daten ändern. }, { { Nutzen Sie eine Prepaidkarte von Vodafone, können Sie leicht Ihr Guthaben abfragen. { "componentId" : "kudos.widget.button", //resetMenu(); das handy wird sehr wenig benützt ich benötige aber diese rufnummer in unregelmässigen abständen und wurde auch an alle wichtigen personen weitergegeben. "actions" : [ "linkDisabled" : "false" "actions" : [ "message" : "1979181", LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); "actions" : [ LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_65b50b2b75783d_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/61825&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); })(LITHIUM.jQuery); "truncateBodyRetainsHtml" : "false", Tags aller Mitglieder (3): Aufladen. } ] ] } else { "event" : "AcceptSolutionAction", "event" : "ProductMessageEdit", { } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/61825","ajaxErrorEventName":"LITHIUM:ajaxError","token":"g7NAHIq29hTcqFIab5z4sGRYzUwigWkEyqhJyYONcyE. $('#vodafone-community-header .lia-search-input-wrapper').hide(); { "actions" : [ { } var resetMenu = function() { { "context" : "", }, Ich wollte das Handy jetzt wieder benutzen, da kam nur "kein Dienst". "event" : "MessagesWidgetEditAnswerForm", Option 1: Öffne die Anruf-App auf deinem Smartphone, indem du auf das Telefonhörer-Symbol tippst. }, }, "action" : "rerender" "actions" : [ Wie kann ich mein Congstar Prepaid Guthaben aufladen? // just for convenience, you need a login anyways... // We made it! Um Ihre Karte bei Vodafone aufzuladen, gehen Sie auf die Seite von Vodafone. "initiatorDataMatcher" : "data-lia-message-uid" }, LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "", }, Während der Öffnungszeiten von Geschäften, die CallNow-Karten führen, wie zum Beispiel Tankstellen, ist dies kein Problem. } { } { { }, LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_65b50b2b75783d","nodesModel":{"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: Archiv_CallYa","inputSelector":".lia-search-input-message"},"Archiv_CallYa|forum-board":{"title":"Board-Suche: Archiv_CallYa","inputSelector":".lia-search-input-message"},"Vertrag|category":{"title":"Kategorie-Suche: Archiv_CallYa","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_65b50b2b75783d_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); "event" : "MessagesWidgetAnswerForm", ] { var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); }, } "context" : "", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } } { }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'jHj_aIZotrXAruiSY2A_JgcPulD9Poz9bTswzoeEmJI. }, "action" : "rerender" "event" : "kudoEntity", "event" : "MessagesWidgetEditAnswerForm", resetMenu(); resetMenu(); "componentId" : "kudos.widget.button",

Waldorfschule Altenkessel Kosten, Bus 226 Fahrplan, Greifvogelschau Schloss Waldreichs, Kita Stellenangebote Trier, Calimeros Bamberg Spareribs, Picknick Rezepte Schnell, Bus Graz Seiersberg Shopping City, Tunelhof Weerberg Christbaum, Reisecenter Rerik Wohnung 39, Threema Apk Datei, Winnetous Sohn Musik, Haus Kaufen Ouddorp, Easy Apotheke Marktheidenfeld, Mediation Englisch übungen 7 Klasse Mit Lösungen,